DPCstruct | MC10287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 468 ± 34 aa |
| Standard deviation of domain lengths | 34.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2DLI9 | 18-433 | STGLVYNDTLARKTRIWQRFWRSLFKSRELYVDVEKRMQELVDICTKEGITNFRNDLFAPNDAIKQARKLSFFLEGPDCYFRSDSVK… |
| A0A166U7N9 | 2-490 | RNIVKKLTHRMDFSIDIFSPRLDISPSSLHTRRRIWQEAVSTLLLTSPECKIPVKQTMTFAQAPDSQYPPYLLNFADSPAERHVENL… |
| K3X6Q6 | 1-415 | None |
| U9U913 | 117-552 | None |
| A0A238F1Y2 | 44-494 | None |
| A2DN42 | 383-821 | None |
| K3X585 | 239-748 | None |
| W4KM39 | 424-896 | None |
| A0A662YBT1 | 715-1212 | None |
| A0A5C3Q3L3 | 667-1137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.