DPCstruct | MC10285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 232 ± 46 aa |
| Standard deviation of domain lengths | 45.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.36 |
| Pfam Score | 71.79 |
| Assigned Pfam label(s) | PF13919- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NJC2 | 523-782 | QEVWNQLPASARQECLELLPDIDKVYPEDAEEQTESSGAELRSDFLQYNSFLTEAIDDFTACLSSGAYAPSFLRSALVTNAACADGL… |
| A0A166SWT2 | 7-221 | HDSHFVAAANTFQDHIFSGWRSEAQADLLARFDQGVRNGTVHAPWKDEVWESTNPPESTLLAGEAAEQDLRYIIESSLLKVGDILAY… |
| A0A1S8W7Q3 | 613-895 | None |
| A0A2N0PS60 | 1-228 | None |
| A0A2T6ZUL4 | 362-599 | None |
| A0A5B8MUR0 | 195-379 | None |
| A0A5K1JZA7 | 231-522 | None |
| U9T395 | 27-248 | None |
| A0A2Z6R5U7 | 24-248 | None |
| A0A6A6NSB3 | 268-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.