DPCstruct | MC10284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0CQB6 | 8-111 | ENLQRHPVLRKLTLNDVVQYARLVGHLKNDILLPQPLEQTDPGVPPDVLPLSLVEFLSLALSIKQEFIQDSWDIMKYYIWECTTVPL… |
| A0A166SG19 | 1-114 | MLKLQSNLAALSGLSISTLVQFISCAAHLKDDILLTQPADMDASMAPEILPPGIRTFLGNACDIPLDCVDVYWLALKETVWQDGSQR… |
| A0A4Y9XQ24 | 8-117 | None |
| A0A5M3MIY7 | 5-112 | None |
| A0A0C9WHU3 | 10-115 | None |
| J0D6Q1 | 10-110 | None |
| A0A409WE57 | 1-118 | None |
| A0A0D0ANK1 | 1-108 | None |
| A0A0D0ACS6 | 3-94 | None |
| A0A0C3EKT6 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.