DPCstruct | MC10282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482ZQ92 | 16-140 | RRIKKLYDNQEAFLLRELTPNQLEIDHKFPQIRWGDNEKENSLTMSESEIKKRFVLLNRSNNLLKSRYCEKCVKTGKRGIFPGIYFW… |
| D0ITQ5 | 1-115 | MCGVRGNSENTQIEIDHKDGRKDDLRVSDLNTQTFDDFQALCKACNDKKRQICKKCKESGYRFDATKIPGNRYPFYEGAIEYDGCVG… |
| A0A6M6E8P2 | 83-199 | None |
| A0A417DE14 | 123-240 | None |
| A0A6A9SZ99 | 259-384 | None |
| A0A6L7W6E8 | 79-215 | None |
| A0A1W9SAD7 | 95-193 | None |
| A0A6C0I0G6 | 115-258 | None |
| A0A7J9SJW4 | 164-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.