DPCstruct | MC10280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 183 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 92.65 |
| Assigned Pfam label(s) | PF17708- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7XHL2 | 2-170 | QNVVFSSLLAMLRDREALQDLMDELEQEPFGHLDGPGGAILTELRKDSCYPEVGSKCLLLYLLEALMVLSDIQHDLLAQSMERRILL… |
| A0A5N4CGH9 | 66-261 | TEDFQGLQLEVGAWAAGLEGLSEEPCGQLLGGLGQVLQDEHALEALEELLERGLCGGQVEPQDGPVGAILECLVLPSRQLEEELAGP… |
| A0A5J5CE83 | 48-235 | None |
| L5JQ63 | 1-177 | None |
| A0A485N8E4 | 375-569 | None |
| A0A5N4D2M0 | 23-178 | None |
| A0A3L8Q817 | 129-334 | None |
| S7PBC3 | 9-191 | None |
| A0A834DN21 | 19-228 | None |
| A0A6P6BKB3 | 281-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.