DPCstruct | MC1028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 416 ± 50 aa |
| Standard deviation of domain lengths | 49.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0010- PF02979- PF21006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8W5Y5 | 1-301 | MKRFAAGDIVRVLALGKTGHVRIPHYIRNQIGRVTEYCGTYLNPEDLAVGNTSGRAVDLYRVAFAQTQLWPNDVIPHHDTLIIEIYD… |
| A0A6B2L404 | 40-428 | LNLHVFRRCIESLEDSVYRSASYFERWAFGLSQVLLEKGAILQGEIDERMGTFEKADLQPQFKVGDKVRVKYENYATRWRKPHLRTP… |
| A0A814PEV8 | 669-1096 | None |
| A0A814KEX5 | 1-388 | None |
| A0A812NNY8 | 867-1276 | None |
| A0A813GZP9 | 114-608 | None |
| F2U4X2 | 4-411 | None |
| A0A812WZZ2 | 476-864 | None |
| A0A0L0FXY1 | 40-476 | None |
| A0A813JDE0 | 25-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.