DPCstruct | MC10279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.53 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF10574- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067QXL1 | 123-226 | IKPKGSLVEETMEHYAMHTLDTAYVWSVKRRQGYGMGMLQNITSSYPGKDIGFSKPISFSMWKVLRKYLQHNADYRNKFWEIEGTGG… |
| A0A5N4CEQ2 | 28-144 | REQRVSLAFPAGGLCGDGTGACYLLPVFDTVFVRKRYRHQGLGLAMLWDFCETFREVEALGVSWPISTAMYQVCRKFLAAHPEERGR… |
| A0A5C6MDS2 | 10-115 | None |
| A0A6B0R5M6 | 304-411 | None |
| A0A6J3FSY3 | 60-185 | None |
| A0A6J1XTZ2 | 168-292 | None |
| A0A7J6D1A5 | 179-285 | None |
| A0A3B4A2T2 | 124-223 | None |
| A0A498MAU7 | 19-119 | None |
| A0A6A4VSW8 | 417-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.