DPCstruct | MC10276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5LSY5 | 2-152 | LQELHPDCGLSNRIRVANHVCDLAKAKKFEEHAVEAVWKAVEDMLTPEQPPEARHAVLLLLRAIIQGQGERLGPLRAFFFKVIRDYQ… |
| A0A5N4BZ98 | 37-197 | MAKPTSKDSGFKEKFRILLGLGTPRPNPRSAEGKQTEFIITAEILRELSVECGLSNRIRVIGQICEVAKTKKFEEHAVEALWKAVSD… |
| A0A4U5NG67 | 4-156 | None |
| A0A7J7KGJ8 | 49-195 | None |
| A0A5N5TAE1 | 1-170 | None |
| A0A1I8H5A0 | 3-174 | None |
| A0A0S7JVF9 | 1-170 | None |
| A0A2R8QLK3 | 3-160 | None |
| L0PED8 | 1-156 | None |
| B7QCI8 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.