DPCstruct | MC10274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368F714 | 23-126 | LREFSGVENCDEATRKGMMDFCYYLSIGQMDEAFKAIRFIKSESVWEHMASMSVKTRRLDVAAVCLGNMKNIRGARALRKAQEAGES… |
| A0A0J7NAG8 | 1-105 | MRDFEELGDCDSITRKAVMDFSYYISVANMEEAFKAIKSIKNEAVWKSLAKMCVKTKQLNMALLCLGHMKQANAARALREAMQNDTL… |
| A0A653CD11 | 44-152 | None |
| A0A7S1JK20 | 268-366 | None |
| A0A183WR15 | 73-176 | None |
| A0A2R6WWR5 | 309-415 | None |
| A0A6I9Z0P3 | 36-139 | None |
| A0A653CAI0 | 46-152 | None |
| A0A7R9BGY6 | 55-159 | None |
| A0A3P7LM94 | 106-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.