DPCstruct | MC10272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 266 ± 53 aa |
| Standard deviation of domain lengths | 53.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835GFM7 | 227-443 | AFQSISNFIETEIIENNKVMYLAQLFLRYQALLLEFGNYEIDFDDIQDYRSETLQKKLIRKFGDRITIEASTAIRNKKIVYKTDMDV… |
| A0A0J7MW63 | 59-306 | ITDLETVFKNVCHYIEENDECQFTLTELLDEMKAYTPEPETLKSKLLKRYGEKIIIHEKTGRPTLVCFRGNDYEALIDSWYNNKGKT… |
| A0A835CQ56 | 97-370 | None |
| A0A6S7FBT3 | 3-268 | None |
| A0A6S7FCH9 | 176-475 | None |
| A0A6S7FHQ1 | 214-553 | None |
| A0A6S7GHV3 | 3-220 | None |
| A0A6S7GRS3 | 109-373 | None |
| C4A046 | 9-355 | None |
| A0A7M5XAR3 | 123-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.