DPCstruct | MC10270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 156 ± 25 aa |
| Standard deviation of domain lengths | 25.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5KXD1 | 36-193 | SWRKACTQCGCSVEDHGQSSDLEDDHKMGRLLADSKYVHLTAKVKGIRVYKRNRMVITNPVVSRKDPTFNTITYDWAPPGLTQKLAM… |
| A0A0J7LAJ4 | 171-300 | VRKNCTSCKCPREAHDVCHEEWVSVRSRLGLKGDESSGPIGVDARERGLAWAPPGLPSHKMEEYFSMLPEIAIPRLGTPGERHRDRQ… |
| A0A6V7WYS1 | 293-464 | None |
| A0A6P8T3R6 | 3-176 | None |
| A0A7R9AYH8 | 4-154 | None |
| A0A182KG81 | 50-178 | None |
| T1GXZ2 | 1-136 | None |
| A0A834II78 | 20-153 | None |
| A0A6H5FX84 | 4-151 | None |
| A0A4Z2BAS6 | 4-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.