DPCstruct | MC1027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 254 ± 28 aa |
| Standard deviation of domain lengths | 28.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6Q1D9 | 84-352 | AGPEVVRLLRSFGQGAAVFLYAWERTGGGRLPDPDEVSATAEERLAAELGEAASTATVCWWTIRRFGLAAKTMLSQAEVRSAVRSEA… |
| A0A6B2L3V3 | 139-406 | FTTFVKGISSIFQESKVLLQGTTLYDKYKSKIVGEDSSSVASSIADVPDSMEIALARFIPPMAEIFGPSLIAREALRKKGIECTWSL… |
| A0A7W8VBZ9 | 84-348 | None |
| A0A7W7WWX8 | 11-292 | None |
| A6LX91 | 134-389 | None |
| A0A4Q7JSP4 | 93-363 | None |
| A0A0M4D4Q1 | 114-330 | None |
| A0A517Y2Q0 | 18-263 | None |
| A0A1M7QZB9 | 5-211 | None |
| A0A4R4PY07 | 85-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.