DPCstruct | MC10268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 92 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0680- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7L0H0 | 10-93 | NGIPELLDYAKRLGINPDAEPHLLDLAREGLMAALPKGWSPCFHEASGAWYYYEAATGTTTWEHPLDAVYRGLVEQARTGNKRQ |
| A0A150GBL8 | 100-186 | RAPTDEEIERMNQYFGIHADEDMYIQEVGQLACVAPLPEGWVELEQPGTGFVSYKDTKTGVILDEHPLDTYFRELRDRRRRELARRR |
| A0A812L2L5 | 3-87 | None |
| K3X694 | 4-109 | None |
| A0A3R7D2N0 | 5-90 | None |
| A0A7J6L4T5 | 471-550 | None |
| A0A7J6LY83 | 43-132 | None |
| A0A5B8MES4 | 14-117 | None |
| A9T0Y3 | 32-118 | None |
| A0A7S2AHG8 | 28-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.