DPCstruct | MC10266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 312 ± 29 aa |
| Standard deviation of domain lengths | 29.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1USC9 | 92-409 | LSVLKDVPRSPLEMIKDPVSDHERMGLYPNLDYKGLFNAISQLVDSAPHIQYGVQAFGQSVLQCLGCLLPFLEYDMIDNLPYLVAYC… |
| A0A0J7KYB0 | 19-350 | LSLLKEVREVPFEMIKSQQFDGERMALYPNLDYKQLYNALTQLVDVVPLIHIGLQAFGKALLQCLACLLPFLDHDLIDNLSYLTAST… |
| A0A0N4VS91 | 9-286 | None |
| A0A0P4WEN1 | 47-360 | None |
| A0A815HCB1 | 29-326 | None |
| G3NZK1 | 26-392 | None |
| E2BRI3 | 11-301 | None |
| A0A0M3INV8 | 32-377 | None |
| A0A095AEG0 | 2-269 | None |
| A0A077YX75 | 53-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.