DPCstruct | MC10265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847I6P8 | 80-193 | GDISCDIDGSLACTTRATDPAAPVYVYDAMTGETIDGVAGRGPVVLAVDFLPCELPIDASNYFSRTLRPFIPALARADFSAPLPGSG… |
| A0A0J7KXK5 | 2-121 | NECTTIDTPFCLYDADRNKDMKSFKGPGVLVCSIDNMPTQLPRESTDFFGNLLYPYALDIIRSDAKKPLDEHNFSPAVHGAIIASNG… |
| A0A162R2W9 | 359-460 | None |
| A0A7R9P9F2 | 138-272 | None |
| A0A1S8X2D6 | 220-329 | None |
| A0A7C1BGJ1 | 2-112 | None |
| A0A654GPX5 | 203-315 | None |
| A0A1D6QD29 | 60-167 | None |
| A0A523RN46 | 34-148 | None |
| I1C6F4 | 147-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.