DPCstruct | MC10263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 207 |
|---|---|
| Mean domain length (aa) | 153 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.89 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | PF12571- PF10983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5X4F7 | 2-124 | ATIVNAGLTEVAKLIVGADSPVAFTYIALGSGTTAEANDQTALVTEITTNGGERASATASYEADYKGKLVKTFSFTGPLSVNEVGVF… |
| A0A6L8M073 | 3-156 | LAVTITEQGLAECVNKKTKGIHAEIKWISVGDRDYTPSATQTSLRNEKQRVEISEYRDTGEASLQCTAKFSGDSEFAIREIGIWLSS… |
| R6ST59 | 5-151 | None |
| A0A2N5KWY1 | 9-185 | None |
| A0A3R8L890 | 2-125 | None |
| A0A0F9MPC9 | 82-192 | None |
| A0A3R6KGD8 | 2-173 | None |
| A0A5E8H5R3 | 2-149 | None |
| A0A0F9F9R6 | 19-132 | None |
| F5XYQ3 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.