DPCstruct | MC1026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 508 ± 55 aa |
| Standard deviation of domain lengths | 55.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7G9A2 | 34-586 | GDRDLNCNIILQYRCQDDTKHQTLNYHSIRNGRYTHTPQYHKNTYTRRSSKNSRLHHDSSSYTRGLHESWEWYDKCNKRNRNKGLFT… |
| A0A6B2KZZ5 | 58-570 | WGPPMTFYEKSLLQVEWTAQHGCGTDNNNVDCDLILQYMCHPLVRDGFVTDTITEDTKDTMEVDPKTGVLVYKYGMHEPFEYFSACK… |
| R7THY6 | 37-543 | None |
| A0A2B4SMY6 | 413-968 | None |
| A0A812QWP0 | 29-558 | None |
| A0A1I8FTY9 | 7-451 | None |
| A0A210PGA4 | 8-446 | None |
| A0A7S4HTS0 | 56-614 | None |
| A0A058Z5M6 | 102-673 | None |
| A0A812LZ11 | 63-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.