DPCstruct | MC10259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B6WVR1 | 10-126 | KIWATVIAVFILGCATGAALSSLYHLKASSNARQMGNKKEAFFDELRRDLSLTDEQAAQIRLILDQTNEQFRQLRAEVRPRYEAIRQ… |
| A0A2V9KEB1 | 1-122 | MTRRAYLYFVLTFLLGGAVGGSGMYFYAWHSGRWSRGFSKEHVVRHLKHELGLSEPQVHQLHEILDEFDGKFAGLHRQVEPQFTALE… |
| A0A1M7PTN0 | 2-142 | None |
| W0RHR2 | 1-116 | None |
| A0A2N9MK31 | 4-132 | None |
| A0A7X7PH97 | 2-131 | None |
| A0A1F9VPZ3 | 3-121 | None |
| A0A6B1ACV2 | 1-128 | None |
| A0A7V3T7C2 | 1-174 | None |
| A0A4Q1C9K0 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.