DPCstruct | MC10254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 142 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.90 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF09557- PF11181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5BR83 | 1-109 | MSGILTRLYDADDAAGQVVVALEQQGIEAGAIRVIARIDGIMAALAEAGVAHEEAEVYAEGVRRGGTLVCVSVDTAQVDAACAALDS… |
| Q7ND51 | 102-254 | TLAGLFVDRRSAEAAIADLDANGFNLDTLGVALAERQEQRELINATGTQTVEEAAEGGSGILGTIANLLSPREPALAEKLVELLTGM… |
| C6VZL8 | 1-138 | None |
| H0PSK0 | 1-147 | None |
| A0A1I1WKJ5 | 169-355 | None |
| A0A536DK77 | 42-183 | None |
| A0A0D3L8M4 | 1-113 | None |
| A0A3N5B0B8 | 1-107 | None |
| A6UGU9 | 10-137 | None |
| A0A838RNI9 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.