DPCstruct | MC10250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 201 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5R1X8 | 87-283 | GADVQEVPVMNNLPLTRARRARLYEVIDSSAPGEEQLHNGGNQQTTPGNLHHQTMPAPVPAISMALCIPNTRVDSNYKPFSDISRRV… |
| A0A6A5S2T9 | 47-241 | MHDTRKPAKPTGPPKVTNPSKQSSSSEPTRASKKSRLSQPVVVSNAAEPASETTTDQVAQLPPVEWVFWVQVSEEVGYWRLFSEFPN… |
| A0A178AUV2 | 213-407 | None |
| W6ZIZ7 | 92-293 | None |
| A0A6A5WYZ6 | 265-468 | None |
| A0A6A6TG45 | 137-321 | None |
| A0A2T2PAW2 | 295-492 | None |
| A0A6S6WQP0 | 418-647 | None |
| M2VD07 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.