DPCstruct | MC1025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 600 ± 101 aa |
| Standard deviation of domain lengths | 100.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1LRG3 | 5-458 | LPTLVAILERETRGWFLHFRERLIAELRAQKLPDEDIEKEVNEAVMREYLQRVYNSIHSHPDIVSLGEGIPKLFVEQAQSIVLMHKA… |
| A0A6B2KY87 | 1-591 | MKVWELLFKNGEVANRLSEIFSEVERKWSMERVLFREEFIRGHKEDGLSEMELTKLLEDETIHLANERLLKAVERDEKLDWFHPLLP… |
| A0A0V0QZY2 | 181-763 | None |
| W8AV59 | 115-688 | None |
| A0A834K7E4 | 1-720 | None |
| A0A5K3EKH0 | 48-648 | None |
| T1GTI0 | 83-739 | None |
| A0A816RJ28 | 2-576 | None |
| A0A821AFY0 | 278-1020 | None |
| A0A6B2KZ02 | 4-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.