DPCstruct | MC10249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 222 ± 30 aa |
| Standard deviation of domain lengths | 29.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168KZ05 | 244-422 | HLVRMYEKDLEMRSLQTNDLGDEKEIGIHCPNVLTFGSFPDRNLRPYFRATSRLSMVMHVPELSLVIIGSPMGRVLLLTPTRLPSPQ… |
| B2W2I2 | 236-414 | VSLIKPSNPFLIITKEEIFLFQSPQVKQGQSRPECVVTMRRPLHPGEWSLDLVPEDRHCYFAQIPELGVFLVGSPIGRVGVFTLYWT… |
| A0A2N6NEM3 | 4-221 | None |
| A0A094FV33 | 23-240 | None |
| A0A0M8MZ72 | 127-311 | None |
| M1VWJ3 | 530-785 | None |
| A0A4U0XRC7 | 934-1151 | None |
| S3C8L8 | 820-1039 | None |
| A0A842ZA80 | 306-507 | None |
| A0A7C8R3K4 | 281-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.