DPCstruct | MC10248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 13.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF16727- PF14377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IJ90 | 143-268 | KLKKPDPPLLGPRRIRLPPKPARPTFTTQELSTLDELRKTLTTWYREFENEGPHPDDVSAMERYLKRVIIDERDLAKVVGVVKWLEW… |
| B2VS09 | 1-138 | MNAFQPTVTRETKAPEAPEPAPKIEIPRPPKPTFTTQKLSKEADLRGAMKQWVGSFTDEAPYGEDVTALVKYLHNVVLEERNLSKAV… |
| F6UF65 | 1-171 | None |
| C9SHT7 | 417-563 | None |
| A0A315W685 | 42-190 | None |
| A0A4W6CRB0 | 862-1013 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.