DPCstruct | MC10247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 61.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819NPN2 | 114-175 | TTNRVYRVIQCQEKEVTQLMSSLSDGWKFEQLIGHSPVGSSYMYPEGEFLCIVSKQYDRGTR |
| A0A0L8H242 | 2-72 | KNVYRVLQCSEEELTQMVSTMSDGWKFEQLINIGSQYTYGTEDHVEFLCVVSKECPNIVNGQENEPTDRAK |
| A0A6P8HT32 | 125-200 | None |
| A0A3P7FT65 | 21-84 | None |
| A0A6G0U4P3 | 137-204 | None |
| U3I1D4 | 137-214 | None |
| A0A7R8CZC4 | 246-327 | None |
| A0A3G1ZL42 | 159-241 | None |
| A0A452DWA9 | 12-87 | None |
| S4RTX7 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.