DPCstruct | MC10244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 66.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3ACR0 | 87-149 | MTCNDSGYQAIQFDPQTHLPTITDNCTGCNLCLSVCPIIDCIKMVTRTTPYEPNRGLPLAVDS |
| A0A0L8GQ69 | 1-71 | MVCNDSGYQAITFDSVTHKAHVTDNCTGCNLCASVCPIIDCIEMIPRTTPFAPKRGPFPLKISTSSQLGEY |
| A0A3P6Q667 | 1-65 | None |
| E4YZ06 | 644-711 | None |
| A0A6J0VLC6 | 220-282 | None |
| A0A3P7FSE3 | 149-214 | None |
| A0A6G0XZF1 | 655-729 | None |
| A0A6S7HC72 | 273-335 | None |
| A0A7R9B4G3 | 238-297 | None |
| A0A834QR93 | 170-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.