DPCstruct | MC10243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834W2R9 | 2-106 | TMRKSINEVELQDLGQTGLSIEEAERFHKVLKETIALVEGSDPRELWRELVARRVLKPWHPHQLHQLVYYSVYAQWDASTKGPPLYW… |
| A0A843VE53 | 2-98 | VVYKRLGEVAVEDIAAAGVPPDEAARVHEELARVLRETGGGSRPEQTWRCLSRRVLRPEQPFALHQLMFYGCYRDYGSDTPPAWIPD… |
| A0A5N6PCS9 | 1-111 | None |
| A0A2N9GNX4 | 232-335 | None |
| A0A4S4DYV1 | 1-93 | None |
| A0A7C8Z3F6 | 50-168 | None |
| A0A438JV95 | 135-224 | None |
| A0A6A1W1A0 | 1-111 | None |
| A0A0A0L0E9 | 24-112 | None |
| A0A484K317 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.