DPCstruct | MC10242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843V9C1 | 51-120 | VTGRRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVKKVLKIQKPKEK |
| W7G1J1 | 236-300 | DCKTAIQGVKALRPADNYRARRKNRTVARAYGGSICARCIRERIMRAFLFEEQKCVRQVLKEKKK |
| H2PE31 | 75-141 | None |
| A0A421J870 | 999-1064 | None |
| A0A1J1IF69 | 206-276 | None |
| A0A091DSS4 | 49-103 | None |
| A0A812S057 | 161-226 | None |
| A0A7J0E920 | 31-84 | None |
| A0A7J0EEI2 | 79-144 | None |
| A0A7J0EPN5 | 64-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.