DPCstruct | MC10241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 190 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF03094- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6N1B5 | 264-446 | FVRLILEQVLVRPGRSLAETPTYSVATVITVLVFVCFIVERSIYRFGKWLKKTRRKALFASLEKIKDELMLLGLISLLLAQWARWIS… |
| A0A2G9GLA1 | 1-155 | MAGESGGDSASLQTTPTWAVATVCFILIAVSILIEHGLHLLAKYLGKKRRKSLLQALNKIKSDLLLLGFISLLLTICERPISKICIP… |
| A0A834TPV9 | 1-231 | None |
| A0A1D6DSZ9 | 1-237 | None |
| A0A2P2NHU2 | 1-179 | None |
| A0A6N2LY10 | 54-259 | None |
| A0A4D8ZH21 | 1-154 | None |
| A0A452YS57 | 2-164 | None |
| A0A4S8K2W5 | 1-188 | None |
| A0A5C7H651 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.