DPCstruct | MC1024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 422 ± 86 aa |
| Standard deviation of domain lengths | 86.13 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 95.79 |
| Assigned Pfam label(s) | CL0031- CL0680- CL0266- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54FY6 | 64-523 | CLGIINLLSGPFIICITDFETIGSIRETQILNRVAKHTITPIARIPISLTEEEKKEEKNYLTLLNDLIESCDLYFSYNFDVTQSEQR… |
| A0A6B2KXC7 | 50-495 | VSGQNPAVSATPQTTDVAYMAVEKFLLSELFYYSYDYHLTLSFQKQEALSEEIKKRSLWKVADRKYFWNYYLQRHFIKKRLHDWILP… |
| A0A803KQX4 | 33-409 | None |
| A0A4S4D9Y3 | 4-273 | None |
| A0A0V0QE67 | 97-584 | None |
| A0A0V0QNA8 | 13-425 | None |
| A0A0N0P5I0 | 487-942 | None |
| A0A6A4Q2I2 | 3-244 | None |
| A0A0D2EFV5 | 20-418 | None |
| R9NVL5 | 227-616 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.