DPCstruct | MC10234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 338 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 92.12 |
| Assigned Pfam label(s) | PF14784- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8ZW98 | 70-405 | DDAAKAAKSALSTRTYFDSDKRNKETFEVMLDIYKKENLNRKGVVEFIYAALKHMDDYKVSYDLEVYKKLIELMPEGKYVPENFYSE… |
| A0A0L0FJY2 | 28-354 | YTKLLEEVRLRPSLEAYNEAIAAYGRRPGKFSKGSVDFIKNCLATMDETGIKPNRATFNGLLDVFPRRRWITRTLFDVIMPKYTPEV… |
| A0A183E7J0 | 1-293 | None |
| A0A2P2I4Q4 | 2-313 | None |
| T2M6R8 | 55-390 | None |
| A0A834PBM1 | 22-356 | None |
| A0A3S1BRD8 | 124-486 | None |
| A0A1I8IX33 | 153-555 | None |
| A0A1V9WZG2 | 40-410 | None |
| A0A0A0MUD4 | 74-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.