DPCstruct | MC10233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 280 ± 50 aa |
| Standard deviation of domain lengths | 50.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5D4N9 | 204-385 | LIPYVHREGGIGHQARDAMLLCMSLSKKNELLGRYIATHSNVCPVLATGLSGLFSRLPRKLAIETEDWHSFTPDDVNEMPELTLFLN… |
| A0A2R7X8M1 | 12-274 | FSLLIPFVHREGTLGQQARDSLLLCMALSKQNDSLAEYIALHSNICPFLATGLSGLYSHLPRKLNVEVDDWYCLTPDDVNDIPELAA… |
| A0A482WYN5 | 198-531 | None |
| A0A6I8SLV6 | 1-273 | None |
| A0A0R3T010 | 179-463 | None |
| A0A077WUT2 | 222-472 | None |
| A0A6G0U8M2 | 620-929 | None |
| A0A4Z2BP88 | 206-567 | None |
| A0A0S7JQY2 | 1-191 | None |
| A0A7R8D2R5 | 301-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.