DPCstruct | MC10232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2ZLS9 | 56-147 | CVADIVSLFITVMDKLRLDIRAMDELHPDLKDLSESMSRMTTLPNHFEGRTKVQTWLTTFAGMAASDDLTDGQARQMLFDMDSAYNA… |
| A0A0L0FIW5 | 2-80 | DSLKLGIVAVDEINPYLNDILESMQKVTTLPSDFEGKITMREWLKKTNAMKASDELTEDDVRQLSHDLEKAHTAFYRSL |
| A0A5J5CTW2 | 140-214 | None |
| A0A2V3ITP2 | 182-276 | None |
| A0A6L2Q213 | 2-70 | None |
| A0A482RPG3 | 4-98 | None |
| A0A1I8JGE2 | 62-141 | None |
| R9AE57 | 110-187 | None |
| A0A7J8RN45 | 113-202 | None |
| A0A0A9P9V3 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.