DPCstruct | MC10230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0FGC2 | 1-96 | MATNYDVKAPEDGLKLINLLVVTKLSRFAYEKVRHPEMSDTELAESLNMRGSMYKSLKTRHDIHQRYVDTMIDILTRHGCHLNVSGV… |
| A0A3R7QMU9 | 1-90 | MSASEPAHLEPANFRPQKVLILTKLSRYEFEKRRHPELTERQLERCLRNRGSDYNMLLYHHYIHKGVENTVNSVFRAAGIETKVVYR… |
| A0A0N7ZC67 | 53-156 | None |
| A0A7R9LCV5 | 2-87 | None |
| A0A0S7KW38 | 1-114 | None |
| H2Y9V6 | 6-106 | None |
| A0A7R9D125 | 1-90 | None |
| A0A0J7KVT9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.