DPCstruct | MC1023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 295 ± 71 aa |
| Standard deviation of domain lengths | 70.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 71.33 |
| Assigned Pfam label(s) | CL0344- CL0072- PF10589- CL0433- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JDI4 | 36-358 | KTKEIILKGSDWIIEEIKKSGLRGRGGAGFPSGMKWSFMNKPSDGRPKYLVINADEGEPGTCKDREIMRHDPHTLIEGCLIAGKAMG… |
| A0A388TFU3 | 89-368 | IKNDFQDELDPNLKQYPPVSELDTETVREIIREIGLVGLGGAAFPTHVKVSPPQDKKVDTLILNAAECEPYLNADYRILLEHPNEVV… |
| A0A504X706 | 115-498 | None |
| A0A377Z2D7 | 16-194 | None |
| A0A7X7XHG8 | 2-301 | None |
| A0A5E8HG42 | 28-330 | None |
| A0A090MT50 | 362-711 | None |
| A0A838RNY4 | 29-248 | None |
| A0A1E3H7Q4 | 121-369 | None |
| T2RDE2 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.