DPCstruct | MC10229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 167 ± 28 aa |
| Standard deviation of domain lengths | 28.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0FG14 | 1-181 | MGTVHSIQETSDLAWQKHGNGYNLTMPHLGTIHLMKDATGRYHAELVLKKVKGHEYQLVDRLPLESDTLASAFAATDSFIKTMFGNM… |
| A0A1S8W9K3 | 76-245 | FSLSFLAKDNTFVRALTHLAWVRVGQEKWVIAFPSKEGLVVLERKSKIYVATYMHHSKRSLSRHLYKLEILRSDSISHAFQGADTFI… |
| A0A0G4KNW0 | 326-506 | None |
| F4P0M3 | 47-213 | None |
| A0A6L4ZSK1 | 455-607 | None |
| A0A2V8JHF3 | 106-227 | None |
| G4TVT1 | 230-456 | None |
| A0A261XUV8 | 98-272 | None |
| N1R5X7 | 321-489 | None |
| A0A1Y2CTH5 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.