DPCstruct | MC10226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 221 ± 26 aa |
| Standard deviation of domain lengths | 25.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P34636 | 18-206 | NAHDWDSFESHHSEPRLRTSNLDVGEYCATFHENYVYYCRGIWTAEKLLEHRSIMKKIGKFCPSYKSACVTRTRIDPEEERERKEDH… |
| A0A7E4VHF4 | 1-263 | MFRLWLFLIFLSSFPFVRTQDDDGLVRFSVAEERMLDDGIRRSSKSRPRTPELVEFTDEEEEVLSHGWKAARHFTGQPTWRQNHIRP… |
| A0A4U5NI36 | 47-298 | None |
| A0A4U5NDK6 | 39-252 | None |
| A0A2A2KHU6 | 158-358 | None |
| A0A1I8CFD5 | 147-389 | None |
| A0A2A2JZK0 | 1-183 | None |
| A0A0D6LCL2 | 285-512 | None |
| A0A7I4YEY9 | 18-221 | None |
| A0A016SI80 | 1-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.