DPCstruct | MC10225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 141 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q21619 | 28-151 | CIVTKNLLFSHGNLIRQLKKDEVDSFKKYKKELHVFNTKINEAFDKAEENEAKNSTVPPMPIRPTLPSFCTGADTTMYIFGACTVQN… |
| A0A7E4VDL4 | 19-164 | AQYVQFAEGIGYIGPACAVVDGNLYIHGIIVRALNSSEIAEFENYQDAISKLHKLRTSPPGDSKKPFMTQPIVPNFCYGLNDNTEVV… |
| A0A0M3HSV4 | 3-156 | None |
| A0A0N5CY07 | 38-187 | None |
| Q19948 | 3-190 | None |
| A0A183TZ62 | 24-187 | None |
| A0A0B2V7F9 | 3-129 | None |
| A0A0B2VDU1 | 77-223 | None |
| A0A0N5AHM4 | 1-97 | None |
| K7HAF4 | 11-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.