DPCstruct | MC10223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4V4A8 | 9-149 | ICEIIKLSKTNTWDDAKYEWQVLNRYKCDFGAQRCLCGHRIGAVVVLYNPTTKQKVEVGNVCVKKFLDFGKKTKIMKMFRLIEADIE… |
| A0A0Q9N247 | 3-148 | GAVVAVEEHPDNEGECLCGQQNLLYMYTIYNSEKQETLSYIGSQCVHHFKRQDLDVQVSVFSQLLALKRAIEDSKKITLTSDYFSRA… |
| M3VAE2 | 13-177 | None |
| A0A519TEK8 | 8-155 | None |
| A0A3F3HE66 | 5-172 | None |
| A0A017NJL3 | 9-170 | None |
| A0A1V5C169 | 25-172 | None |
| A0A2N0DNK9 | 4-155 | None |
| A0A2U3Q9H3 | 4-148 | None |
| A0A6C0K0M3 | 11-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.