DPCstruct | MC10221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 66.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G2DG92 | 1-71 | MREEQVLLAQDYALETARAEGLGQGLERGKVEGREERKLFAFLDIVRQGLLTSEVASQQLGMSVSEFEALL |
| A0A081Q6R7 | 36-120 | MFSEQRRREEQALLAQDYALEQAEERGLERGLERGRAEGREQGREEGIEEGLKVGLVNLVRQGLLTPEVASEQLGMSVAEFESLL |
| A0A3R9I9W2 | 1-93 | None |
| F9HBY1 | 9-65 | None |
| A0A3A4S193 | 1-81 | None |
| A0A2N9ZY71 | 80-175 | None |
| S7X7Z9 | 80-144 | None |
| A0A7X1Q621 | 36-104 | None |
| I0SZY6 | 57-141 | None |
| I0SUJ0 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.