DPCstruct | MC10220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 203 ± 43 aa |
| Standard deviation of domain lengths | 42.79 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0NLX3 | 59-279 | EDVDQFASLVEDYNQTIENTSLHGEFKPEINPEYDFEKIDKLWTSKKGEFIGTNCRINTFVLLKNSIGSKNIPYDNEDLAFDMSALD… |
| A0A654XX01 | 5-220 | SVDEFFNLVNDYNTIVGSTGLSGDFTSFTHTEYDVEKISHLWNQKKGDFVGTNCRINSYCLLKNSVTIPKLEKNDQLLFLDNDAIDK… |
| A0A0M6WK70 | 15-185 | None |
| A0A3E2TTR5 | 20-251 | None |
| A0A416DXP6 | 144-376 | None |
| A0A7X7HY26 | 25-308 | None |
| G6EME0 | 2-135 | None |
| A0A0A0IK98 | 164-399 | None |
| A0A2S0RL00 | 2-137 | None |
| A0A2G6PLJ1 | 115-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.