DPCstruct | MC1022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257QNC1 | 303-376 | YTGQICFAKLTNNGQNYTNASVSFNGSGSGATGSVFMANGQVIGIAISNGGVGYGPGTTAIISGDGTGATATVQ |
| A0A1F1BZS2 | 370-450 | YGLNQISDIKVTNGGSGYTSPPKVIITGGGDEAYDAKARAKIKDGKVIEIRIERVGSRYMVPPTVTIEGGGGSGATAEAYV |
| A0A1Z9PN78 | 117-193 | None |
| A0A5C8JGG8 | 163-238 | None |
| A0A6C0FHF9 | 82-166 | None |
| A0A0Q6FK15 | 805-888 | None |
| A0A2V7WD79 | 299-398 | None |
| A0A356HVI7 | 375-457 | None |
| B4D4I1 | 272-337 | None |
| A0A2D6FMA6 | 299-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.