DPCstruct | MC10217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7MYL5 | 2-137 | GGFVDGIVLHQILQWHQMLSAKLPPDTLLNKEVNMFWDGIFHAFTWLTTAVGIGLLWRLIYRRDAALSNRIFVGGLFFGFGLFNVVE… |
| D6YAD5 | 4-137 | VRPAGLVLGLGIGGFIDGIVLHQLLGWHHMLSGWYPDDLRLNMIGDGAFHALCLVLVIAGVAMLSRAAPHRLGELFGWMITGWGLFN… |
| A0A4Q5WSD0 | 20-177 | None |
| A0A327L630 | 11-162 | None |
| A0A1G9U6W5 | 3-141 | None |
| U2YIJ7 | 5-153 | None |
| A0A8B5XGX2 | 12-158 | None |
| A0A0N8KMR4 | 1-116 | None |
| A0A4U5WWS3 | 2-131 | None |
| V7EHI7 | 45-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.