DPCstruct | MC10214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 317 ± 37 aa |
| Standard deviation of domain lengths | 36.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0BLG2 | 120-464 | SEHKGKMFIEIPEVYELVNVAMALTHIGIEDRNMIYKNSEYYARVRQHFDRFKDHPLITELDSALKKNLNMYATLKMNGNAFEFDQK… |
| A0A1H2FYF0 | 54-397 | DKIIVENPEVYELMQIACSLTETFQNDQNLTNHKTGYYTNFINHFKSYKNHELVLKLNEYLKPNPYGSSQFAIRLLSLNYEINDSNK… |
| A0A4S8HYW5 | 32-228 | None |
| A0A7Y4RTR7 | 29-329 | None |
| A0A396C303 | 25-340 | None |
| A0A6M0IQR2 | 96-436 | None |
| A0A351YER9 | 23-355 | None |
| A0A7C1DMR8 | 216-561 | None |
| A0A7W1E6B5 | 1-368 | None |
| A0A7Y6ZH48 | 22-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.