DPCstruct | MC10213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660YDR2 | 7-133 | DKKLISRIIIDKDAAGTLVSYADRLGKQLKNEDLKASQIRAIFDEVRQIEALWLQDEDKAIYKVHLLKPKLAYRAARSSNGVPTLKE… |
| A0A7K3Y040 | 76-196 | LNDENYADFAEQCILKGKQGEGAPFRGLTTTKLRSLYGLIMNVYTRINVREDFETHKSDLQYIKVKMAYEAGREKSVKVFLEKTKLL… |
| A0A7C4GFE1 | 41-173 | None |
| A0A7V0MEI6 | 1-103 | None |
| A0A7V5Y623 | 26-162 | None |
| A0A1I6JKI6 | 7-130 | None |
| A0A3M1FIM2 | 24-172 | None |
| A0A7V1ZGD0 | 11-144 | None |
| A0A661J3S2 | 6-159 | None |
| A0A1V5MM74 | 16-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.