DPCstruct | MC10212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 74.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3IFV4 | 29-90 | DPKPENNIILTQSEGLMLNGRPKNPANARNKNVLVVGGSGSGKTRFFIKPNLMQMHSSYVVT |
| A0A1Q6JY02 | 2-58 | FENNIILTATEWLMMSGRPKNPKFARNKNILVIGGSGSGKTRFFVKPNLMQMHSSYV |
| E6LM26 | 1-49 | None |
| A0A2I0N214 | 2-62 | None |
| A0A417BRY3 | 110-171 | None |
| A0A1C5WHY7 | 1-49 | None |
| A0A1C6IE79 | 108-161 | None |
| K1UDH8 | 1-72 | None |
| A0A328JZZ2 | 3-60 | None |
| A0A7U9RDK3 | 132-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.