DPCstruct | MC10211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 325 |
|---|---|
| Mean domain length (aa) | 297 ± 69 aa |
| Standard deviation of domain lengths | 69.27 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 97.45 |
| Assigned Pfam label(s) | CL0270- CL0063- CL0020- PF17718- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9G0D1 | 3-287 | SICILLTDSESINEKIILKSYNYLLKVKIKKIFFIGSKKKFIKIYNKFSKNQKFRFINIVFKKNKQIDYLTNITNKAITTCKANKRW… |
| A0A380DTA9 | 2-221 | TYNIVALPGDGIGPEILNGSLSLLEIISNKYNFNYQIEHHEFGGASIDTFGEPLTEKTLNACKRADAILLGAIGGPKWTDPNNRPEQ… |
| A0A815IBS2 | 35-358 | None |
| K6Q2A3 | 2-359 | None |
| A0A212CT33 | 155-485 | None |
| A0A3S4HNF5 | 5-229 | None |
| A0A7S2UT29 | 66-393 | None |
| A0A3Q8UC38 | 11-322 | None |
| A0A7V8ZHF2 | 1-312 | None |
| A0A1A9UKL2 | 480-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.