DPCstruct | MC10210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 145 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10564 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6MAU1 | 1-148 | MKLSPFCLVALALFAPVALNGRLVKGAATAEIPEATSTLHGLMDSICVQEFARACLVNPHFCVGAVARRDVGIDAAEGEAWRCYSTV… |
| A0A1D3D772 | 5-172 | AILQPSAARHISPRHKTQALKTQESPQGCASVTGGFALLAGLMREELYFFGLLILYVSLMLSCLHTLLALQNPGAGHLQELLDSACF… |
| U6LB08 | 365-491 | None |
| F0VMS0 | 8-152 | None |
| A0A0F7U3W1 | 79-222 | None |
| A0A2C6L7A7 | 1-150 | None |
| A0A2A9M1X6 | 1-138 | None |
| A0A151HGM9 | 309-453 | None |
| F0VMS3 | 1-150 | None |
| A0A6H0C3U3 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.