DPCstruct | MC1021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072RCW2 | 23-160 | MLRTLRDLVNLAPGTIGFLLISRANAAGTDRIAHVQPFVMTHQGFVLIITNTLGISFERYRTLLSPTTNSARLLYYLSVEGRRNIYA… |
| A0A2H1XD04 | 281-434 | MPLYNWTPSREFTTRSEILSHITSLIGSPAGSIWLALMRRQRPDGTIAGHSVPILRTSEGLVVIPTRVPSSVSLELYREYLTPTMDP… |
| M6Q5E1 | 236-390 | None |
| N1U396 | 32-185 | None |
| M7A1U4 | 2-139 | None |
| M6ZYA1 | 153-307 | None |
| M6RHZ7 | 333-484 | None |
| M6T9Z1 | 1-117 | None |
| A0A3D8HRY8 | 240-383 | None |
| A0A0A8GWE8 | 469-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.