DPCstruct | MC10208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 178 ± 36 aa |
| Standard deviation of domain lengths | 35.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 67.10 |
| Assigned Pfam label(s) | CL0023- PF21516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829GGA9 | 3-122 | VIKPATYQLNEGQTIFLGGLARFDYLRGGRNSFVIYTDNQLTLHRTKLENADDFYQKHVGGLLSPPQADEVPDFPPLVRFEFTPKEK… |
| A0A1D3D116 | 415-589 | LPKGFKLVDTPGIPSSSQITNLLPHGPDLLAVVPSKRLQPVTYALTEGKSLLIGAMARIDLVEGRTALCTCFFSHKITLHICKTSRA… |
| A0A139R3B3 | 1-103 | None |
| A0A3A5IX25 | 55-221 | None |
| A0A813FL94 | 262-530 | None |
| A0A7S0DT23 | 156-316 | None |
| A0A1D5B4I9 | 498-670 | None |
| L8HIZ2 | 241-432 | None |
| A0A445AL45 | 1-87 | None |
| A0A7S2W145 | 12-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.