DPCstruct | MC10206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 221 ± 41 aa |
| Standard deviation of domain lengths | 41.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2FKE7 | 57-272 | SGFGGITGMDRARAADEFDGMREHRKVMLTGGASLNTADTDIAAAITRLTTEANGYWQTMNTSPSRTYLWSDNPGIGNSIHIRVTYE… |
| A0A654UCL3 | 3-155 | KLNQELEGKVADSLSSISSQADRIYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYKDETVVRTVRDSMEWMHKHVYNSEKS… |
| A0A7Y5KD71 | 15-272 | None |
| F3PP21 | 230-452 | None |
| A0A3M3KAZ2 | 215-474 | None |
| A0A2E9IMI8 | 11-245 | None |
| A0A354U655 | 197-418 | None |
| A0A1H6E9W3 | 23-269 | None |
| D4XUV2 | 398-589 | None |
| R5VKS2 | 23-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.